PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G45050.1
Common NameGATA2, T14P1.14
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family GATA
Protein Properties Length: 264aa    MW: 28864 Da    PI: 8.29
Description GATA transcription factor 2
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G45050.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA56.24.6e-18181215135
         GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                  C++C + kTp+WR gp g+ktLCnaCG+++++ +l
  AT2G45050.1 181 CTHCASEKTPQWRTGPLGPKTLCNACGVRFKSGRL 215
                  *******************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169923.3E-962264IPR016679Transcription factor, GATA, plant
SMARTSM004014.8E-15175225IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.227179211IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.71E-14179239No hitNo description
Gene3DG3DSA:3.30.50.101.6E-13179213IPR013088Zinc finger, NHR/GATA-type
CDDcd002027.27E-14180227No hitNo description
PfamPF003207.3E-16181215IPR000679Zinc finger, GATA-type
PROSITE patternPS003440181206IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009416Biological Processresponse to light stimulus
GO:0030154Biological Processcell differentiation
GO:0045944Biological Processpositive regulation of transcription from RNA polymerase II promoter
GO:0005634Cellular Componentnucleus
GO:0005667Cellular Componenttranscription factor complex
GO:0000977Molecular FunctionRNA polymerase II regulatory region sequence-specific DNA binding
GO:0001085Molecular FunctionRNA polymerase II transcription factor binding
GO:0001228Molecular Functiontranscriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
GO:0003682Molecular Functionchromatin binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009030anatomycarpel
PO:0009032anatomypetal
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 264 aa     Download sequence    Send to blast
MDVYGLSSPD LLRIDDLLDF SNEDIFSASS SGGSTAATSS SSFPPPQNPS FHHHHLPSSA  60
DHHSFLHDIC VPSDDAAHLE WLSQFVDDSF ADFPANPLGG TMTSVKTETS FPGKPRSKRS  120
RAPAPFAGTW SPMPLESEHQ QLHSAAKFKP KKEQSGGGGG GGGRHQSSSS ETTEGGGMRR  180
CTHCASEKTP QWRTGPLGPK TLCNACGVRF KSGRLVPEYR PASSPTFVLT QHSNSHRKVM  240
ELRRQKEVMR QPQQVQLHHH HHPF
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.2160.0root
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible266125_at0.0
Expression AtlasAT2G45050-
AtGenExpressAT2G45050-
ATTED-IIAT2G45050-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Mostly expressed in roots. Also expressed in flowers and leaves, and to a lower extent in stems. {ECO:0000269|PubMed:12139008}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a member of the GATA factor family of zinc finger transcription factors.
UniProtTranscriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes. {ECO:0000269|PubMed:12139008}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G45050.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G45050
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3171340.0AK317134.1 Arabidopsis thaliana AT2G45050 mRNA, complete cds, clone: RAFL21-72-C19.
GenBankBT0009210.0BT000921.1 Arabidopsis thaliana clone C105099 putative GATA-type zinc finger transcription factor (At2g45050) mRNA, complete cds.
GenBankY136490.0Y13649.1 Arabidopsis thaliana mRNA for GATA transcription factor 2.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_182031.10.0GATA transcription factor 2
SwissprotO497410.0GATA2_ARATH; GATA transcription factor 2
TrEMBLB9DGF30.0B9DGF3_ARATH; AT2G45050 protein
STRINGAT2G45050.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM32032666
Representative plantOGRP6817287
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Teakle GR,Manfield IW,Graham JF,Gilmartin PM
    Arabidopsis thaliana GATA factors: organisation, expression and DNA-binding characteristics.
    Plant Mol. Biol., 2002. 50(1): p. 43-57
    [PMID:12139008]
  3. Jeong MJ,Jeong MJ,Shih MC
    Interaction of a GATA factor with cis-acting elements involved in light regulation of nuclear genes encoding chloroplast glyceraldehyde-3-phosphate dehydrogenase in Arabidopsis.
    Biochem. Biophys. Res. Commun., 2003. 300(2): p. 555-62
    [PMID:12504119]
  4. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  5. Goda H, et al.
    Comprehensive comparison of auxin-regulated and brassinosteroid-regulated genes in Arabidopsis.
    Plant Physiol., 2004. 134(4): p. 1555-73
    [PMID:15047898]
  6. Reyes JC,Muro-Pastor MI,Florencio FJ
    The GATA family of transcription factors in Arabidopsis and rice.
    Plant Physiol., 2004. 134(4): p. 1718-32
    [PMID:15084732]
  7. Tepperman JM, et al.
    Expression profiling of phyB mutant demonstrates substantial contribution of other phytochromes to red-light-regulated gene expression during seedling de-etiolation.
    Plant J., 2004. 38(5): p. 725-39
    [PMID:15144375]
  8. Nakamura A, et al.
    Arabidopsis Aux/IAA genes are involved in brassinosteroid-mediated growth responses in a manner dependent on organ type.
    Plant J., 2006. 45(2): p. 193-205
    [PMID:16367964]
  9. Zhang L, et al.
    Conservation of noncoding microsatellites in plants: implication for gene regulation.
    BMC Genomics, 2006. 7: p. 323
    [PMID:17187690]
  10. Manfield IW,Devlin PF,Jen CH,Westhead DR,Gilmartin PM
    Conservation, convergence, and divergence of light-responsive, circadian-regulated, and tissue-specific expression patterns during evolution of the Arabidopsis GATA gene family.
    Plant Physiol., 2007. 143(2): p. 941-58
    [PMID:17208962]
  11. Luo XM, et al.
    Integration of light- and brassinosteroid-signaling pathways by a GATA transcription factor in Arabidopsis.
    Dev. Cell, 2010. 19(6): p. 872-83
    [PMID:21145502]